PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A07G2341
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 271aa    MW: 30460.4 Da    PI: 7.3436
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A07G2341genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.68e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed++l  +++ +G g W+  +++ g++R++k+c++rw++yl
      Gh_A07G2341 14 KGAWTALEDKILTSYIHVHGEGKWRNLPKRAGLKRCGKSCRLRWLNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.93.6e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ + +E+el+++++++lG++ W++Ia +++ gRt++++k++w++ 
      Gh_A07G2341  67 RGNISHDEEELIIRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111
                      78999*****************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.637961IPR017930Myb domain
SuperFamilySSF466892.14E-2712108IPR009057Homeodomain-like
SMARTSM007175.5E-121363IPR001005SANT/Myb domain
PfamPF002491.6E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-221568IPR009057Homeodomain-like
CDDcd001679.54E-91661No hitNo description
PROSITE profilePS5129424.1762116IPR017930Myb domain
SMARTSM007176.5E-1566114IPR001005SANT/Myb domain
PfamPF002492.4E-1467111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-2369115IPR009057Homeodomain-like
CDDcd001678.06E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MGRSPCCSKE GLNKGAWTAL EDKILTSYIH VHGEGKWRNL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SHDEEELIIR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TLGKRAKAQA  120
SIEAKTIPTE SRLNEPSKSS TKIEVIRTKA IRCSSKVMVP LQPPATHRHG QHHCTNNNEE  180
MGGGIATIEA HNGIQMLESL YSDGGSDLLS FEINELLKSH DGGEFEENPM QQHFPLGEAV  240
FKDWSTSHCL DDNGATDLES LAFLLDTDEW P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461890.0
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362840.0AF336284.1 Gossypium hirsutum GHMYB36 (ghmyb36) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012488054.10.0PREDICTED: transcription repressor MYB6-like
SwissprotQ9FJA27e-63TT2_ARATH; Transcription factor TT2
TrEMBLA0A0B0N2L30.0A0A0B0N2L3_G
STRINGPOPTR_0006s23840.16e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35550.16e-64MYB family protein